PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA19272
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Nin-like
Protein Properties Length: 949aa    MW: 103581 Da    PI: 6.5227
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA19272genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.11.8e-28620671152
                     RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                aek+isl +l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  Tp57577_TGAC_v2_mRNA19272 620 AEKTISLPVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 671
                                589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.37610691IPR003035RWP-RK domain
PfamPF020424.6E-24624671IPR003035RWP-RK domain
SuperFamilySSF542778.5E-24835931No hitNo description
Gene3DG3DSA:3.10.20.2403.4E-24845926No hitNo description
PROSITE profilePS5174521.745846929IPR000270PB1 domain
SMARTSM006666.5E-26846929IPR000270PB1 domain
CDDcd064071.85E-38847928No hitNo description
PfamPF005645.3E-14847928IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 949 aa     Download sequence    Send to blast
MEYGGGLVGD GGVFGNMVGG GGEAADMIEE LLVDGCWIEA SENNMMAMQS QTQTHYMSTN  60
NNNNNNIPIG MGEGDHFNNH HHNQIECNVP TDHDDDQESG FVVGKRWWIG PRANPGPSTS  120
VKERLVVAVG YLKEYTKNSS NNVLIQIWVP ALRRRSPLLI HNHYLHESSS SAPVSVNPNT  180
NVHVRFFRSH EYPRHQQQQY GSLFALPVFE RGSGTCLGVI EFVITNQTVV NYRPQLDHLS  240
NALEAVDFRS SHNMNIPSAV KVFEELYEAA VNEIVEVLAS VCKTHNLPLA LTWAPCIQQQ  300
GGGVRGKGTA GAAGCGVSVA VPTDQMNNNQ MMMNCVSTVD SACYVGDMEV LGFQEVCSEY  360
HLFNGQGIVG TAFTTTKPCF AIDITAFSKA EYPLAHHANM FGLHAAVAIP LRSVYTGSAA  420
DFVLEFFLPK DCRDPEQQKH MLNSLSLVVQ QACRSLHLHV VIDDTDNANH HDHDQDQFTF  480
PTTTTTNNYM PSSASDAATA SLSQVDATSG CSTKDTSSSC SWIAHMMEAQ HKGKGVSVSL  540
EYLQEPKEEF KVTTCNWDRE REGNSVFSEF GQVLQHDQSS NSRASVEAGE ESGGCGVGGG  600
RRSSSSSSGR KSGDKRRTKA EKTISLPVLR QYFAGSLKDA AKSIGVCPTT LKRICRQHGI  660
TRWPSRKIKK VGHSLKKLQL VIDSVQGAEG AIQIGSFYAS FPELSTATAN GGGGGGGDHN  720
NVNNSFYNSH GDGVVNGLKS PPSACSQTHA AGNKLITANI INGDHHHHHH VMMTENPAAP  780
LAADSLMMHG SNINIQNYQQ LQEDQDTKQL LLHFNNNNQT LPPRPTAGAW NNNNNSSSSG  840
LLERGAFRVK ATFADEKIRF SLQAMWGFRD LQLEIARRFN LNDMNNLVLK YLDDEGEWVV  900
LSCDADLEEC KDLHTSSHTR TIRLSLFQAS PLNIPNNFVR NSSSSPSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003618108.10.0nodule inception protein
TrEMBLQ8H0N00.0Q8H0N0_PEA; Nodule inception protein
STRINGGLYMA04G00210.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein